.

.

Rekombinant Sıçan Toll-etkileşen protein (Tollıp) (Rekombinant Protein)

Rekombinant Sıçan Toll-etkileşen protein (Tollıp) (Rekombinant Protein)

₺ 145.00

Malların
Sipariş verilebilir

Tür adı : Tollip; Tollip. Syn Name : Rekombinant Toll etkileşen protein( Tollip); Toll etkileşen protein.toll etkileşen protein; Toll etkileşen protein; toll etkileşen protein.Kaynak : E Coli veya Maya.Saflık : > %90; * Etiket Bilgisi : Etiketlendi; * Türler : Rattus norvegicus (Sıçan).Depolama Tamponu : PBS p H 7.4, %50 gliserol; * Seq Pos : 2-274. Depolama : -20 derece C'de saklayın. Genişletilmiş depolama için -20 veya -80 derece C'de saklayın.Bu öğe için ÜCRETSİZ-8 GB-USBDrive.Madde araştırma kullanım içindir.Teşhis / tedavi prosedürü için değil. * Form : Bu ürün özel üretim gerektirir ve teslim süresi 5-9 hafta arasındadır.Spesifikasyonlarınıza göre özel üretim yapabiliriz. NP_001103138 ; *Seq : ATTVSTQRGPVYİGELPQDFLRİTPTQQQQQİQLDAQAAQQLQYGGAVGTVGRLSİTVVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVİQCTVPPGVDSFYLEİFDERAFSMDDRİAWTHİTİPESLKQGQVEDEWYSLSGRQGDDKEGMİNLVMSYTSLPAAMMMPPQPVVLMPTVYQQGVGYVPİAGMPAVCSPGMVPMAMPPPAVAPQPRCNEEDLKAİQDMFPNMDREVİRSVLEAQRGNKDAAİNSLLQMGEES; *Katılım* : .1; NM_001109668.1; A2 RUW1; *Uniprot Özeti : gibi IL-1 ve Toll sinyal yolu Fonksiyon : Bileşen-reseptörleri.Mikrobiyal ürünlerle hücre aktivasyonunu inhibe eder.Irak1'i IL-1 reseptör kompleksine alır.IRAK1 fosforilasyonunu ve kinaz aktivitesini benzerlikle inhibe eder.Uni Prot KB q9h0e2alt birim yapısı : Oligomerize olur.C-terminali üzerinden tlr2'ye ve TLR4-MD2 kompleksine bağlanır.Uyarılmamış hücrelerde IRAK1 ile kompleks olarak bulunur.IL-1 sinyallemesi üzerine Tollip, IL-1 RI, IL-1 Rac P ve adaptör proteini My D88 içeren aktive edilmiş IL-1 reseptör kompleksine bağlanır ve burada IL-1racp'nin TIR alanı ile etkileşime girer.My D88 daha sonra IRAK1 otofosforilasyonunu tetikler ve bu da ırak1'in Tollıp ve IL-1racp'den ayrışmasına neden olur.TOM1 L2 ile benzerlikle etkileşime girer.Uni Prot KB q9h0e2hücresel lokasyon : Sitoplazma Olasılığı.Dizi benzerlikleri : Tollip ailesine aittir.1 C2 etki alanı içerir.1 İŞARET alanı içerir.

Temel özellikleri

Verilen bu kadar mal satın